PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05444g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 327aa    MW: 35773.1 Da    PI: 6.8494
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05444g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.7e-18234267134
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                               C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Niben101Scf05444g00004.1 234 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 267
                               99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-712321IPR016679Transcription factor, GATA, plant
SMARTSM004016.4E-18228278IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.517228264IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.107.8E-15232265IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.99E-15232291No hitNo description
CDDcd002021.72E-13233280No hitNo description
PfamPF003202.2E-15234267IPR000679Zinc finger, GATA-type
PROSITE patternPS003440234259IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGSNMVDEID CGSFFDQIDD LIEFPSENEC GGFSSTDCKE FPSIWDQPYD PLFSGSYNNS  60
PSDLSAELSV PYEDIVQLEW LSTFVEDSFS GGGLTLGKEN APINKETSHS KFQSSSPVSV  120
LESSSSSSSS SCSAGKTIPL SPCHRGPQRA RSKRPRPATF NPQPAIQLIS PTSVFIENPR  180
PSSESGNFAQ SPMKKIPRPA AAAEQKTKKK IKFTIPLAPI ETNHNSTAHA VRRCMHCEIT  240
KTPQWRAGPM GPKTLCNACG VRYKSGRLFP EYRPAASPTF VPSMHSNSHK KVLEMRTRDI  300
PDNNVTAGTQ IPATITEQEF GKSSMEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152156KRPRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760862.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_009760863.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016497965.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_016497966.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLQ76DY31e-165Q76DY3_TOBAC; AG-motif binding protein-1
STRINGSolyc05g056120.2.11e-148(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23452358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-40GATA family protein